PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.161430.1
Common NameCsa_2G375240, LOC101206476
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 996aa    MW: 111088 Da    PI: 5.5976
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.161430.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-183884148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
   Cucsa.161430.1 38 KGQWTAEEDEILRKAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 84
                     799****************************9.************986 PP

2Myb_DNA-binding66.64.4e-2190136148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde++v++v+++G++ W+tIa++++ gR +kqc++rw+++l
   Cucsa.161430.1  90 KGPWSKEEDEIIVELVEKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 136
                      79******************************.*************97 PP

3Myb_DNA-binding48.71.8e-15142184145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+   + ++ gRt++ +k++w+
   Cucsa.161430.1 142 KEAWTQEEELALIRAHQIYGNR-WAELTKFLP-GRTDNAIKNHWN 184
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.0153384IPR017930Myb domain
SuperFamilySSF466892.08E-183698IPR009057Homeodomain-like
SMARTSM007172.2E-153786IPR001005SANT/Myb domain
PfamPF002498.4E-163884IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-223992IPR009057Homeodomain-like
CDDcd001673.41E-144184No hitNo description
PROSITE profilePS5129433.85685140IPR017930Myb domain
SuperFamilySSF466894.87E-3287183IPR009057Homeodomain-like
SMARTSM007178.5E-2089138IPR001005SANT/Myb domain
PfamPF002493.0E-1990136IPR001005SANT/Myb domain
CDDcd001671.98E-1792136No hitNo description
Gene3DG3DSA:1.10.10.608.5E-2993140IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-21141191IPR009057Homeodomain-like
PROSITE profilePS5129419.563141191IPR017930Myb domain
SMARTSM007172.2E-15141189IPR001005SANT/Myb domain
PfamPF002491.7E-13142185IPR001005SANT/Myb domain
CDDcd001674.50E-12144184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 996 aa     Download sequence    Send to blast
MESDPPLCTS LDVSGDSGQN IRALHSRRTT GPTRRSTKGQ WTAEEDEILR KAVQRFKGKN  60
WKKIAECFKD RTDVQCLHRW QKVLNPELVK GPWSKEEDEI IVELVEKYGP KKWSTIAQHL  120
PGRIGKQCRE RWHNHLNPAI NKEAWTQEEE LALIRAHQIY GNRWAELTKF LPGRTDNAIK  180
NHWNSSVKKK LESYLASGLL EQYQPLHHAS QSSLPMLSSS RVQSSMDDSS LRGAETEDIS  240
EVSQTSAIGA CSNTIPRTKE ECQLAEDAFL KDEPCSPPHC PGQYHASLDN ITFSIPEMLS  300
ELGCYVKTPN HNFSQDCRTS STEDNRYNLY ELPNISSLEL GHELPHFQAN GSQEVETAPH  360
QTSAGFSAST ADNMATASVK PEHMLISDYE CCTVLFSDAV VNESFPSENT INTSDMVELS  420
GYAHPLHRQS TSIELPESNR NIPLQSYHHA RSDVLDNSCS QRFLAPLLVS ANDDTYVYTS  480
DTSHLFETLE QELVANGHDG FIYTNESTDS PSKNGFMNAE LQKQQGSKDP SKLVPVNTFS  540
SEPKTAENLP SFSGREKTHP DQPDLIGALC YEPPRFPSLD VPFLSCDLAP AASDMQQEYS  600
PLGIRQLMMS SINCLTPFRL WNSPTRDESP DALLKSAAKT FTNTPSILKK RHREFLSPLS  660
DKRCDKKQEI DVGISRTPSH TNPSHQTVNS RSSEDKENIC PAEEVRQEKH SDLYNISHCK  720
RPERTSDSFS FQEKKMQELD NPAANERIDS IGQIEVQQRS RILLECDTNE SLSYSTNRDG  780
VAEMQCSRTS TSLQDQDFPS NLSDDHCALA NCSIASGTCH GRTLEVAGDN ASKESSLETI  840
TIFGGTPFKR SIESPSAWKS PWFINSFLFG SRMDTDEVGL FMSPGDRSYD AIGLMKEVSE  900
QTAAACANAQ EVLGNETPQS LLKGRRGKYE NHNNDKNNHF TNSRSTLAPD ILTERRTLDF  960
SECGTPGKGT ENGKSSTATT RSFSSPSSYL LKGCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-69381916159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-69381916159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150290.10.0PREDICTED: myb-related protein 3R-1
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0A0LLZ90.0A0A0A0LLZ9_CUCSA; Uncharacterized protein
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]